PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca51258.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 404aa    MW: 45140.9 Da    PI: 7.2958
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca51258.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.62.9e-54261521128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhPtdeelvv+yLk+k+++ +l++  +i+evd+yk++Pw+Lp+k+  +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+vls+++++
  Dca51258.1  26 LPPGFRFHPTDEELVVHYLKRKAQSLSLPV-AIIAEVDLYKFDPWELPAKAIFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLSAGKQK 123
                 79****************************.88***************7777899******************************************** PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                 vg+kk Lvfy g+ p+g+kt+W+mheyrl
  Dca51258.1 124 VGVKKALVFYGGKPPRGVKTNWIMHEYRL 152
                 ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-6520187IPR003441NAC domain
PROSITE profilePS5100560.93526187IPR003441NAC domain
PfamPF023652.5E-2827152IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MESTNSTAAA ACGSHQPPPQ QPQPHLPPGF RFHPTDEELV VHYLKRKAQS LSLPVAIIAE  60
VDLYKFDPWE LPAKAIFGEQ EWYFFSPRDR KYPNGARPNR AATSGYWKAT GTDKPVLSAG  120
KQKVGVKKAL VFYGGKPPRG VKTNWIMHEY RLADNKPNNK PPGYDHSHNK KGSLRLDDWV  180
LCRIYKKNNT PRPMDQDRED SMEDIMRMGP ISSLSSLQNS IHNTMGHHHP SLTKTTLNYS  240
SLLEAAHDHH NNNHNQISFF DHGLMSGPHH GMDHLGSAST STVQLKRAMP SAATLYWGAV  300
EHDTTDDSPS KRMSLLHSSN DNDDTNNNNN MDQDNSGRGN NDHVSNDDNN NNDDNNNVNS  360
IASLLNQFPA QTPSSLHQQS MLGGISDGVF RQPYPIPPGL NWYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-752319014168NAC domain-containing protein 19
4dul_A2e-752319014168NAC domain-containing protein 19
1ut7_B2e-752319014168NO APICAL MERISTEM PROTEIN
1ut7_A2e-752319014168NO APICAL MERISTEM PROTEIN
1ut4_B2e-752319014168NO APICAL MERISTEM PROTEIN
1ut4_A2e-752319014168NO APICAL MERISTEM PROTEIN
3swp_D2e-752319017171NAC domain-containing protein 19
3swp_C2e-752319017171NAC domain-containing protein 19
3swp_B2e-752319017171NAC domain-containing protein 19
3swp_A2e-752319017171NAC domain-containing protein 19
3swm_D2e-752319017171NAC domain-containing protein 19
3swm_C2e-752319017171NAC domain-containing protein 19
3swm_B2e-752319017171NAC domain-containing protein 19
3swm_A2e-752319017171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009334622.11e-136PREDICTED: NAC domain-containing protein 18
SwissprotQ9LD441e-107NAC56_ARATH; NAC transcription factor 56
TrEMBLD9ZJA41e-135D9ZJA4_MALDO; NAC domain class transcription factor
STRINGGLYMA13G35560.11e-132(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-108NAC domain containing protein 2